PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S06820.20
Common NameJCGZ_05961, LOC105634574
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family MIKC_MADS
Protein Properties Length: 230aa    MW: 27171.1 Da    PI: 7.5794
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S06820.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.92e-26959151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   krien++ rqvtfskRr+g+lKK +ELSvLC+a++ +iifsstgkl  y++
  Jcr4S06820.20  9 KRIENQTTRQVTFSKRRAGLLKKTHELSVLCEAQIGLIIFSSTGKLCQYCT 59
                   79***********************************************96 PP

2K-box752.1e-2571168197
          K-box   1 yqkssgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                    yqk +g++  e+   e+l+ ela L+ke++ Lq + R++ Ged++s+ +++L +LeqqLe s+ kiRs+Knell +q+++l +k ++l+een ++ 
  Jcr4S06820.20  71 YQKLTGTKiPEDDRRENLYDELAMLRKETRRLQLNMRRYTGEDMSSIPFEDLDELEQQLEYSVAKIRSRKNELLQQQLDNLHRKVRMLEEENGNIY 166
                    788889998899999*****************************************************************************9887 PP

          K-box  96 kk 97 
                    + 
  Jcr4S06820.20 167 RW 168
                    65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.73161IPR002100Transcription factor, MADS-box
SMARTSM004326.6E-38160IPR002100Transcription factor, MADS-box
CDDcd002652.03E-40276No hitNo description
SuperFamilySSF554552.62E-30279IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.2E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-263859IPR002100Transcription factor, MADS-box
PfamPF014867.6E-2481169IPR002487Transcription factor, K-box
PROSITE profilePS5129714.56985175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008360Biological Processregulation of cell shape
GO:0019252Biological Processstarch biosynthetic process
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:2000029Biological Processregulation of proanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MGRGKIPIKR IENQTTRQVT FSKRRAGLLK KTHELSVLCE AQIGLIIFSS TGKLCQYCTE  60
PFRMEQIIER YQKLTGTKIP EDDRRENLYD ELAMLRKETR RLQLNMRRYT GEDMSSIPFE  120
DLDELEQQLE YSVAKIRSRK NELLQQQLDN LHRKVRMLEE ENGNIYRWIQ DHRVAMEYQQ  180
ATIEAKPVEH QHVLDQFPFC GEPSSVLQLA TIPSQIHSYH LQLAQPNLQE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-17171169Myocyte-specific enhancer factor 2B
1tqe_Q2e-17171169Myocyte-specific enhancer factor 2B
1tqe_R2e-17171169Myocyte-specific enhancer factor 2B
1tqe_S2e-17171169Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2166822e-40AC216682.1 Populus trichocarpa clone POP024-L07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012072837.11e-170PREDICTED: protein TRANSPARENT TESTA 16
SwissprotQ8RYD96e-92TT16_ARATH; Protein TRANSPARENT TESTA 16
TrEMBLA0A067KN081e-170A0A067KN08_JATCU; Uncharacterized protein
STRINGPOPTR_0007s07620.11e-120(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49352952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.26e-87MIKC_MADS family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]